Research Use Only • Premium Laboratory Standards
€42.95
| Specification | Details |
|---|---|
| Product Name | LL-37 |
| Amount | 10 mg per vial |
| Peptide Type | Human Cathelicidin Antimicrobial Peptide |
| Amino Acid Sequence | [LL-37, 37 aa] |
| Research Category | Immunology, Microbiology & Innate Immunity |
| Purity | ≥99.5% HPLC Tested* |
| Form | Lyophilised Powder |
| Documentation | Batch-Specific Certificate of Analysis |
| Storage | Store at 2–8°C, protected from light and moisture |
Fast Processing
We process all orders as quickly as possible, usually within 24 hours. Our team works efficiently to ensure fast dispatch without unnecessary delays.
Fast & Reliable Delivery
We use trusted shipping carriers to ensure safe and efficient delivery:
Netherlands & Belgium: 1–3 business days
Europe: 3–7 business days
International: 5–12 business days
We always aim for the fastest possible delivery times.
Track Your Order
Once your order has been shipped, you will receive a tracking number so you can follow your package in real time.
Secure & Discreet Packaging
All orders are shipped in plain, secure packaging for privacy and protection.
Support
If you have any questions about your delivery, our support team is ready to help you quickly.
All products are tested to ensure consistency, quality, and reliability.
Each batch is analyzed to confirm it meets strict internal quality standards before being released.
We prioritize transparency and accuracy, and results are reviewed carefully to ensure product integrity.
If you have any questions regarding testing or documentation, our support team is available to assist you.
Always use products exactly as intended and follow the recommended guidelines provided on the product page. Do not exceed suggested use.
Disclaimer
All information provided on this website is for informational purposes only and is not intended as medical advice.
Individual results may vary. This website does not guarantee any specific outcomes.
By using this website and purchasing products, you acknowledge that you are responsible for your own use and decisions.
If you are unsure about suitability, consult a qualified professional before use.