LL-37 10mg

Looking to buy LL-37 10mg for laboratory research? LL-37 is a human cathelicidin antimicrobial peptide (AMP) widely studied in preclinical research involving innate immunity, host defence, microbial interactions and tissue repair. As the only known cathelicidin-derived antimicrobial peptide naturally expressed in humans, LL-37 has become one of the most extensively investigated peptides in immunology and infection research. Derived from the hCAP18/CAMP precursor protein, LL-37 consists of 37 amino acids and forms an amphipathic α-helical structure. Researchers continue to investigate its interactions with bacterial membranes, immune signalling pathways and inflammatory processes, making it an important research tool in microbiology, immunology and regenerative biology. At Peptides Divas, LL-37 10mg is supplied as a premium-quality lyophilised peptide manufactured to high purity standards. Every batch is accompanied by a Certificate of Analysis (COA), allowing researchers to verify purity and analytical specifications before use. This product is intended strictly for laboratory research purposes only. It is not intended for human or veterinary use.

Product Specifications

Specification	Details
Product Name	LL-37
Amount	10 mg per vial
Peptide Type	Human Cathelicidin Antimicrobial Peptide
Amino Acid Sequence	[LL-37, 37 aa]
Research Category	Immunology, Microbiology & Innate Immunity
Purity	≥99.5% HPLC Tested*
Form	Lyophilised Powder
Documentation	Batch-Specific Certificate of Analysis
Storage	Store at 2–8°C, protected from light and moisture

*Subject to batch-specific COA.

Scientific Research

Innate Immunity Research

LL-37 is widely investigated for its role within the innate immune system. Researchers study its interactions with microbial membranes, host defence mechanisms and peptide-mediated immune signalling pathways in controlled laboratory models.

Antimicrobial Peptide Research

As the only naturally occurring human cathelicidin peptide, LL-37 has been extensively investigated for its activity against Gram-positive bacteria, Gram-negative bacteria, fungi and certain enveloped viruses in experimental settings. These studies focus on understanding peptide–membrane interactions rather than clinical applications.

Wound Healing and Tissue Biology

Experimental research has explored the potential involvement of LL-37 in keratinocyte migration, angiogenesis and tissue repair processes. These findings remain part of ongoing preclinical research and continue to be investigated in laboratory models.

Immune Cell Signalling

LL-37 is also studied for its potential interactions with neutrophils, monocytes and T lymphocytes through immune signalling pathways, including receptors such as FPRL1/FPR2. These investigations contribute to a broader understanding of inflammatory regulation and innate immune responses.

Biofilm Research

Researchers continue to investigate LL-37 in experimental models involving bacterial biofilms and microbial persistence. This area of research is particularly relevant for understanding host–pathogen interactions and biofilm biology.

Inflammation Research

LL-37 has also been studied for its complex role in inflammatory signalling. Depending on the experimental model and biological environment, research suggests that the peptide may influence both pro-inflammatory and anti-inflammatory pathways, making it an important topic in immunological research.

Why Researchers Choose LL-37

• Research-grade quality
• High-purity lyophilised peptide
• Batch-specific Certificate of Analysis
• Reliable batch consistency
• Secure packaging
• Fast worldwide shipping
• Dedicated customer support

Why Buy from Peptides Divas?

Peptides Divas supplies premium research peptides backed by transparent quality control and batch-specific analytical documentation. Every order is carefully packaged and dispatched quickly from our European warehouse. Researchers choose Peptides Divas for consistent product quality, dependable batch testing and responsive customer support.

Research Use Only

LL-37 10mg is supplied exclusively for scientific and laboratory research. This product is not intended for human consumption, therapeutic use, diagnostic procedures, cosmetic applications or veterinary use.