LL-37
€42.95
- Delivery within 1-2 business days
- Pickup at collection point available
- Discreetly Packaged
LL-37 Peptide 10mg for Laboratory Research
LL-37 peptide 10mg is a synthetic research peptide based on the naturally occurring human cathelicidin LL-37. The peptide consists of 37 amino acids and has a molecular weight of approximately 4493.3 g/mol.
Researchers study LL-37 in controlled laboratory models involving peptide structure, microbial membrane interactions, cell signalling, and innate biological responses. However, these areas remain subjects of scientific research. Laboratory findings should not be treated as proven medical outcomes.
Each vial contains 5mg of high-purity, lyophilised LL-37. Therefore, researchers receive a clearly specified amount for accurate laboratory planning and documentation.
What Is the LL-37 Peptide?
LL-37 is a 37-amino-acid peptide derived from the C-terminal region of the human cathelicidin precursor protein, also known as hCAP18 or CAMP. Its name comes from the first two leucine amino acids and its total length of 37 residues.
The LL-37 peptide belongs to the cathelicidin peptide family. In published laboratory studies, researchers have examined its structure, charge, membrane interactions, and biological activity.
LL-37 has a positive net charge and can form an alpha-helical structure under certain experimental conditions. As a result, it is useful in laboratory studies that focus on peptide–membrane interactions. In addition, researchers use it as a reference compound when comparing natural and modified peptide sequences.
LL-37 Research Applications
Researchers have examined LL-37 in several experimental areas. These studies may use biochemical, microbial, cellular, or structural models.
Common research areas include:
- Peptide structure and stability
- Cathelicidin peptide research
- Microbial membrane interaction studies
- Innate immune signalling models
- Cellular response research
- Peptide aggregation studies
- Structure–activity comparisons
- Development of LL-37-derived peptide analogues
These applications describe published research areas only. They do not suggest that the product has an approved therapeutic or diagnostic use.
Why Choose LL-37 from Peptides Divas?
Peptides Divas supplies carefully selected products for laboratory research. Moreover, each product page gives researchers clear technical details before they order.
Key product features include:
- 5mg of LL-37 per vial
- High-purity synthetic peptide
- Complete 37-amino-acid sequence
- Lyophilised powder
- Sealed research vial
- Clear product identification
- Secure and discreet packaging
- Fast European order processing
- Batch documentation where available
Because clear documentation matters, researchers can request available batch information before placing an order.
LL-37 Peptide Specifications
- Product name: LL-37
- Quantity: 10mg per vial
- Peptide family: Cathelicidin
- Form: Lyophilised powder
- Peptide length: 37 amino acids
- Molecular formula: C205H340N60O53
- Molecular weight: Approximately 4493.3 g/mol
- CAS number: 154947-66-7
- Purity specification: ≥99.5% by HPLC
- Appearance: White to off-white powder
- Solubility: Depends on the selected laboratory solvent and protocol
- Intended use: Laboratory research only
LL-37 Amino Acid Sequence
The complete single-letter amino acid sequence is:
[LL-37, 37 aa]
The sequence contains 37 amino acids. Therefore, laboratories can use it for analytical comparison, structural studies, and peptide identification.
Quality and Batch Documentation
Reliable specifications support accurate research. For this reason, Peptides Divas provides batch-related analytical information where available.
The purity specification for LL-37 peptide 10mg is based on HPLC analysis. Available documentation may include the batch number, tested purity, analysis date, and other analytical details.
Because every production batch is separate, results may differ slightly. Researchers should always review the documentation connected to the current batch.
Please contact Peptides Divas if you need specific analytical information before ordering.
Storage and Handling
Keep the unopened vial in a cool, dry, and dark place. Also, protect the product from heat, direct sunlight, and moisture.
For longer storage, keep the vial refrigerated or frozen according to a validated laboratory protocol. Avoid repeated temperature changes. In addition, allow the sealed vial to reach the required temperature before opening it. This step can help reduce moisture exposure.
Researchers must select suitable solvents and preparation methods for their own experiments. After preparation, stability will depend on the solvent, concentration, temperature, and laboratory conditions.
Shipping and Delivery
Peptides Divas packs every vial carefully to help protect it during transport. Furthermore, orders receive secure outer packaging for safe and discreet delivery.
We begin processing paid orders as quickly as possible. Once the parcel leaves our fulfilment location, customers receive shipping information by email.
Delivery times can vary by country, destination, and carrier. Browse our complete range of laboratory research products to combine several products in one order.
Research Reference
For additional chemical identifiers and publicly available compound information, view the LL-37 entry on PubChem.
Important Research Disclaimer
LL-37 peptide 10mg is supplied strictly for laboratory and analytical research. It is not intended for human or veterinary consumption.
This product is not a medicine, supplement, cosmetic, or food product. Furthermore, it must not be used to diagnose, prevent, treat, or cure any medical condition.
Only trained and qualified researchers should handle this material in a suitable laboratory environment.
Secure Shipping and Delivery
Peptides Divas carefully packs each research vial to protect it during storage and transport. Orders receive secure outer packaging for safe and discreet delivery.
We start processing the order after payment confirmation. Once the parcel has been prepared and transferred to the carrier, shipping information will be sent by email.
Delivery times depend on the country, destination, and selected carrier. Therefore, customs procedures, public holidays, carrier delays, or incorrect address details may affect delivery.
Please check your name, address, postal code, and country before completing the order.
LL-37 Peptide Lab Results
The stated purity specification for LL-37 peptide 5mg is ≥99.5% by HPLC. Available batch documentation may contain:
- Product identification
- Batch or lot number
- HPLC purity result
- Analysis date
- Molecular information
- Storage recommendations
- Additional analytical data where available
Because each production batch is separate, always review the document connected to the current batch.
Please contact Peptides Divas if you need batch-specific information before placing your order.
Laboratory Research Use Only
LL-37 peptide 5mg is supplied only for laboratory, analytical, and scientific research. It is not intended for human or veterinary consumption.
The product is not a medicine, food, supplement, or cosmetic. It must not be used to diagnose, prevent, treat, or cure any condition.
The buyer is responsible for safe storage, handling, and use. In addition, the buyer must follow all applicable laws, local regulations, and laboratory safety procedures.
