LL-37 Peptide 10mg for Laboratory Research

LL-37 peptide 10mg is a synthetic research peptide based on the naturally occurring human cathelicidin LL-37. The peptide consists of 37 amino acids and has a molecular weight of approximately 4493.3 g/mol.

Researchers study LL-37 in controlled laboratory models involving peptide structure, microbial membrane interactions, cell signalling, and innate biological responses. However, these areas remain subjects of scientific research. Laboratory findings should not be treated as proven medical outcomes.

Each vial contains 5mg of high-purity, lyophilised LL-37. Therefore, researchers receive a clearly specified amount for accurate laboratory planning and documentation.

What Is the LL-37 Peptide?

LL-37 is a 37-amino-acid peptide derived from the C-terminal region of the human cathelicidin precursor protein, also known as hCAP18 or CAMP. Its name comes from the first two leucine amino acids and its total length of 37 residues.

IL LL-37 peptide belongs to the cathelicidin peptide family. In published laboratory studies, researchers have examined its structure, charge, membrane interactions, and biological activity.

LL-37 has a positive net charge and can form an alpha-helical structure under certain experimental conditions. As a result, it is useful in laboratory studies that focus on peptide–membrane interactions. In addition, researchers use it as a reference compound when comparing natural and modified peptide sequences.

LL-37 Research Applications

Researchers have examined LL-37 in several experimental areas. These studies may use biochemical, microbial, cellular, or structural models.

Le aree di ricerca più comuni includono:

• Peptide structure and stability
• Cathelicidin peptide research
• Microbial membrane interaction studies
• Innate immune signalling models
• Cellular response research
• Peptide aggregation studies
• Structure–activity comparisons
• Development of LL-37-derived peptide analogues

These applications describe published research areas only. They do not suggest that the product has an approved therapeutic or diagnostic use.

Why Choose LL-37 from Peptides Divas?

Peptides Divas supplies carefully selected products for laboratory research. Moreover, each product page gives researchers clear technical details before they order.

Le caratteristiche principali del prodotto includono:

• 5mg of LL-37 per vial
• Peptide sintetico ad elevata purezza
• Complete 37-amino-acid sequence
• Polvere liofilizzata
• Fiala di ricerca sigillata
• Clear product identification
• Imballaggio sicuro e discreto
• Elaborazione rapida degli ordini in Europa
• Documentazione di lotto, ove disponibile

Because clear documentation matters, researchers can request available batch information before placing an order.

LL-37 Peptide Specifications

• Nome del prodotto: LL-37
• Quantità: 10 mg per flaconcino
• Peptide family: Cathelicidin
• Modulo: Polvere liofilizzata
• Lunghezza del peptide: 37 amino acids
• Formula molecolare: C205H340N60O53
• Peso molecolare: Approximately 4493.3 g/mol
• Numero CAS: 154947-66-7
• Specifiche di purezza: ≥99,5% mediante HPLC
• Aspetto: Polvere da bianca a biancastra
• Solubility: Depends on the selected laboratory solvent and protocol
• Uso previsto: Solo ricerca di laboratorio

LL-37 Amino Acid Sequence

The complete single-letter amino acid sequence is:

[LL-37, 37 aa]

The sequence contains 37 amino acids. Therefore, laboratories can use it for analytical comparison, structural studies, and peptide identification.

Documentazione relativa alla qualità e ai lotti

Reliable specifications support accurate research. For this reason, Peptides Divas provides batch-related analytical information where available.

The purity specification for LL-37 peptide 10mg is based on HPLC analysis. Available documentation may include the batch number, tested purity, analysis date, and other analytical details.

Because every production batch is separate, results may differ slightly. Researchers should always review the documentation connected to the current batch.

Please contact Peptides Divas if you need specific analytical information before ordering.

Stoccaggio e movimentazione

Keep the unopened vial in a cool, dry, and dark place. Also, protect the product from heat, direct sunlight, and moisture.

For longer storage, keep the vial refrigerated or frozen according to a validated laboratory protocol. Avoid repeated temperature changes. In addition, allow the sealed vial to reach the required temperature before opening it. This step can help reduce moisture exposure.

Researchers must select suitable solvents and preparation methods for their own experiments. After preparation, stability will depend on the solvent, concentration, temperature, and laboratory conditions.

Spedizione e consegna

Peptides Divas packs every vial carefully to help protect it during transport. Furthermore, orders receive secure outer packaging for safe and discreet delivery.

We begin processing paid orders as quickly as possible. Once the parcel leaves our fulfilment location, customers receive shipping information by email.

Delivery times can vary by country, destination, and carrier. Browse our complete range of laboratory research products to combine several products in one order.

Riferimento di ricerca

For additional chemical identifiers and publicly available compound information, view the LL-37 entry on PubChem.

Avviso importante sulla ricerca

LL-37 peptide 10mg is supplied strictly for laboratory and analytical research. It is not intended for human or veterinary consumption.

This product is not a medicine, supplement, cosmetic, or food product. Furthermore, it must not be used to diagnose, prevent, treat, or cure any medical condition.

Only trained and qualified researchers should handle this material in a suitable laboratory environment.