LL-37 10mg

Ønsker at købe LL-37 10mg for laboratory research? LL-37 is a human cathelicidin antimicrobial peptide (AMP) widely studied in preclinical research involving innate immunity, host defence, microbial interactions and tissue repair. As the only known cathelicidin-derived antimicrobial peptide naturally expressed in humans, LL-37 has become one of the most extensively investigated peptides in immunology and infection research. Derived from the hCAP18/CAMP precursor protein, LL-37 consists of 37 amino acids and forms an amphipathic α-helical structure. Researchers continue to investigate its interactions with bacterial membranes, immune signalling pathways and inflammatory processes, making it an important research tool in microbiology, immunology and regenerative biology. At Peptider Divas, LL-37 10mg is supplied as a premium-quality lyophilised peptide manufactured to high purity standards. Every batch is accompanied by a Analysecertifikat (COA), hvilket giver forskere mulighed for at verificere renhed og analytiske specifikationer før brug. Dette produkt er udelukkende beregnet til laboratorieforskningsformål. Det er ikke beregnet til human eller veterinær brug.

Produktspecifikationer

Specifikation	Detaljer
Produktnavn	LL-37
Beløb	10 mg pr. hætteglas
Peptidtype	Human Cathelicidin Antimicrobial Peptide
Aminosyresekvens	[LL-37, 37 aa]
Forskningskategori	Immunology, Microbiology & Innate Immunity
Renhed	≥99,5% HPLC-testet*
Form	Frysetørret pulver
Dokumentation	Batchspecifik analysecertifikat
Opbevaring	Opbevares ved 2-8 °C, beskyttet mod lys og fugt

*Med forbehold for batchspecifik COA.

Videnskabelig forskning

Innate Immunity Research

LL-37 is widely investigated for its role within the innate immune system. Researchers study its interactions with microbial membranes, host defence mechanisms and peptide-mediated immune signalling pathways in controlled laboratory models.

Antimicrobial Peptide Research

As the only naturally occurring human cathelicidin peptide, LL-37 has been extensively investigated for its activity against Gram-positive bacteria, Gram-negative bacteria, fungi and certain enveloped viruses in experimental settings. These studies focus on understanding peptide–membrane interactions rather than clinical applications.

Wound Healing and Tissue Biology

Experimental research has explored the potential involvement of LL-37 in keratinocyte migration, angiogenesis and tissue repair processes. These findings remain part of ongoing preclinical research and continue to be investigated in laboratory models.

Immune Cell Signalling

LL-37 is also studied for its potential interactions with neutrophils, monocytes and T lymphocytes through immune signalling pathways, including receptors such as FPRL1/FPR2. These investigations contribute to a broader understanding of inflammatory regulation and innate immune responses.

Biofilm Research

Researchers continue to investigate LL-37 in experimental models involving bacterial biofilms and microbial persistence. This area of research is particularly relevant for understanding host–pathogen interactions and biofilm biology.

Inflammation Research

LL-37 has also been studied for its complex role in inflammatory signalling. Depending on the experimental model and biological environment, research suggests that the peptide may influence both pro-inflammatory and anti-inflammatory pathways, making it an important topic in immunological research.

Why Researchers Choose LL-37

• Kvalitet i forskningsklasse
• Højrent frysetørret peptid
• Batchspecifik analysecertifikat
• Pålidelig batchkonsistens
• Sikker emballage
• Hurtig verdensomspændende levering
• Dedikeret kundesupport

Hvorfor købe fra Peptides Divas?

Peptides Divas leverer førsteklasses forskningspeptider bakket op af transparent kvalitetskontrol og batchspecifik analytisk dokumentation. Hver ordre pakkes omhyggeligt og sendes hurtigt fra vores europæiske lager. Forskere vælger Peptides Divas for ensartet produktkvalitet, pålidelig batchtestning og responsiv kundesupport.

Kun til brug for forskning

LL-37 10mg is supplied exclusively for scientific and laboratory research. This product is ikke beregnet til konsum, terapeutisk brug, diagnostiske procedurer, kosmetiske anvendelser eller veterinær brug.