LL-37 10mg

Sto cercando di acquistare LL-37 10mg for laboratory research? LL-37 is a human cathelicidin antimicrobial peptide (AMP) widely studied in preclinical research involving innate immunity, host defence, microbial interactions and tissue repair. As the only known cathelicidin-derived antimicrobial peptide naturally expressed in humans, LL-37 has become one of the most extensively investigated peptides in immunology and infection research. Derived from the hCAP18/CAMP precursor protein, LL-37 consists of 37 amino acids and forms an amphipathic α-helical structure. Researchers continue to investigate its interactions with bacterial membranes, immune signalling pathways and inflammatory processes, making it an important research tool in microbiology, immunology and regenerative biology. At Dive dei Peptidi, LL-37 10mg is supplied as a premium-quality lyophilised peptide manufactured to high purity standards. Every batch is accompanied by a Certificato di analisi (COA), consentendo ai ricercatori di verificare la purezza e le specifiche analitiche prima dell'uso. Questo prodotto è destinato esclusivamente alla ricerca di laboratorio. Non è destinato all'uso umano o veterinario.

Specifiche del prodotto

Specifiche	Dettagli
Nome del prodotto	LL-37
Quantità	10 mg per flaconcino
Tipo di peptide	Human Cathelicidin Antimicrobial Peptide
Sequenza di amminoacidi	LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Categoria di ricerca	Immunology, Microbiology & Innate Immunity
Purezza	≥99,5% Testato con HPLC*
Modulo	Polvere liofilizzata
Documentazione	Certificato di analisi specifico per lotto
Magazzinaggio	Conservare a 2–8 °C, al riparo dalla luce e dall'umidità.

*Soggetto a certificato di analisi specifico per lotto.

Ricerca scientifica

Innate Immunity Research

LL-37 is widely investigated for its role within the innate immune system. Researchers study its interactions with microbial membranes, host defence mechanisms and peptide-mediated immune signalling pathways in controlled laboratory models.

Antimicrobial Peptide Research

As the only naturally occurring human cathelicidin peptide, LL-37 has been extensively investigated for its activity against Gram-positive bacteria, Gram-negative bacteria, fungi and certain enveloped viruses in experimental settings. These studies focus on understanding peptide–membrane interactions rather than clinical applications.

Wound Healing and Tissue Biology

Experimental research has explored the potential involvement of LL-37 in keratinocyte migration, angiogenesis and tissue repair processes. These findings remain part of ongoing preclinical research and continue to be investigated in laboratory models.

Immune Cell Signalling

LL-37 is also studied for its potential interactions with neutrophils, monocytes and T lymphocytes through immune signalling pathways, including receptors such as FPRL1/FPR2. These investigations contribute to a broader understanding of inflammatory regulation and innate immune responses.

Biofilm Research

Researchers continue to investigate LL-37 in experimental models involving bacterial biofilms and microbial persistence. This area of research is particularly relevant for understanding host–pathogen interactions and biofilm biology.

Inflammation Research

LL-37 has also been studied for its complex role in inflammatory signalling. Depending on the experimental model and biological environment, research suggests that the peptide may influence both pro-inflammatory and anti-inflammatory pathways, making it an important topic in immunological research.

Why Researchers Choose LL-37

• Qualità di livello di ricerca
• Peptide liofilizzato ad elevata purezza
• Certificato di analisi specifico per lotto
• Affidabilità e coerenza del lotto
• Imballaggio sicuro
• Spedizione veloce in tutto il mondo
• Assistenza clienti dedicata

Perché acquistare da Peptides Divas?

Peptides Divas fornisce peptidi di alta qualità per la ricerca, supportati da un controllo qualità trasparente e da una documentazione analitica specifica per ogni lotto. Ogni ordine viene accuratamente imballato e spedito rapidamente dal nostro magazzino europeo. I ricercatori scelgono Peptides Divas per la qualità costante dei prodotti, i test affidabili sui lotti e l'assistenza clienti reattiva.

Solo per uso di ricerca

LL-37 10mg is supplied exclusively for scientific and laboratory research. This product is non Destinato al consumo umano, all'uso terapeutico, alle procedure diagnostiche, alle applicazioni cosmetiche o all'uso veterinario.