LL-37 10mg

Chcę kupić LL-37 10mg for laboratory research? LL-37 is a human cathelicidin antimicrobial peptide (AMP) widely studied in preclinical research involving innate immunity, host defence, microbial interactions and tissue repair. As the only known cathelicidin-derived antimicrobial peptide naturally expressed in humans, LL-37 has become one of the most extensively investigated peptides in immunology and infection research. Derived from the hCAP18/CAMP precursor protein, LL-37 consists of 37 amino acids and forms an amphipathic α-helical structure. Researchers continue to investigate its interactions with bacterial membranes, immune signalling pathways and inflammatory processes, making it an important research tool in microbiology, immunology and regenerative biology. At Peptydy Divas, LL-37 10mg is supplied as a premium-quality lyophilised peptide manufactured to high purity standards. Every batch is accompanied by a Certyfikat analizy (COA), co pozwala badaczom na sprawdzenie czystości i specyfikacji analitycznych przed użyciem. Ten produkt jest przeznaczony wyłącznie do celów badań laboratoryjnych. Nie jest przeznaczony do użytku przez ludzi ani zwierzęta.

Specyfikacja produktu

Specyfikacja	Bliższe dane
Nazwa produktu	LL-37
Kwota	10 mg na fiolkę
Typ peptydu	Human Cathelicidin Antimicrobial Peptide
Sekwencja aminokwasów	[LL-37, 37 aa]
Kategoria badań	Immunology, Microbiology & Innate Immunity
Czystość	≥99,5% HPLC przetestowane*
Formularz	Liofilizowany proszek
Dokumentacja	Certyfikat analizy dla konkretnej partii
Składowanie	Przechowywać w temperaturze 2–8°C, chronić od światła i wilgoci.

*Z zastrzeżeniem COA specyficznego dla danej partii.

Badania naukowe

Innate Immunity Research

LL-37 is widely investigated for its role within the innate immune system. Researchers study its interactions with microbial membranes, host defence mechanisms and peptide-mediated immune signalling pathways in controlled laboratory models.

Antimicrobial Peptide Research

As the only naturally occurring human cathelicidin peptide, LL-37 has been extensively investigated for its activity against Gram-positive bacteria, Gram-negative bacteria, fungi and certain enveloped viruses in experimental settings. These studies focus on understanding peptide–membrane interactions rather than clinical applications.

Wound Healing and Tissue Biology

Experimental research has explored the potential involvement of LL-37 in keratinocyte migration, angiogenesis and tissue repair processes. These findings remain part of ongoing preclinical research and continue to be investigated in laboratory models.

Immune Cell Signalling

LL-37 is also studied for its potential interactions with neutrophils, monocytes and T lymphocytes through immune signalling pathways, including receptors such as FPRL1/FPR2. These investigations contribute to a broader understanding of inflammatory regulation and innate immune responses.

Biofilm Research

Researchers continue to investigate LL-37 in experimental models involving bacterial biofilms and microbial persistence. This area of research is particularly relevant for understanding host–pathogen interactions and biofilm biology.

Inflammation Research

LL-37 has also been studied for its complex role in inflammatory signalling. Depending on the experimental model and biological environment, research suggests that the peptide may influence both pro-inflammatory and anti-inflammatory pathways, making it an important topic in immunological research.

Why Researchers Choose LL-37

• Jakość na poziomie badawczym
• Wysokiej czystości liofilizowany peptyd
• Certyfikat analizy dla konkretnej partii
• Niezawodna spójność partii
• Bezpieczne opakowanie
• Szybka wysyłka na cały świat
• Dedykowane wsparcie klienta

Dlaczego warto kupować od Peptides Divas?

Peptides Divas dostarcza najwyższej jakości peptydy badawcze, objęte transparentną kontrolą jakości i dokumentacją analityczną dla każdej partii. Każde zamówienie jest starannie pakowane i szybko wysyłane z naszego europejskiego magazynu. Naukowcy wybierają Peptides Divas ze względu na stałą jakość produktów, rzetelne testy partii i szybką obsługę klienta.

Tylko do celów badawczych

LL-37 10mg is supplied exclusively for scientific and laboratory research. This product is nie przeznaczone do spożycia przez ludzi, do użytku terapeutycznego, do celów diagnostycznych, do zastosowań kosmetycznych lub do użytku weterynaryjnego.