LL-37 10mg

Hledám koupi LL-37 10mg for laboratory research? LL-37 is a human cathelicidin antimicrobial peptide (AMP) widely studied in preclinical research involving innate immunity, host defence, microbial interactions and tissue repair. As the only known cathelicidin-derived antimicrobial peptide naturally expressed in humans, LL-37 has become one of the most extensively investigated peptides in immunology and infection research. Derived from the hCAP18/CAMP precursor protein, LL-37 consists of 37 amino acids and forms an amphipathic α-helical structure. Researchers continue to investigate its interactions with bacterial membranes, immune signalling pathways and inflammatory processes, making it an important research tool in microbiology, immunology and regenerative biology. At Peptidy Divas, LL-37 10mg is supplied as a premium-quality lyophilised peptide manufactured to high purity standards. Every batch is accompanied by a Certifikát analýzy (COA), což umožňuje výzkumníkům ověřit čistotu a analytické specifikace před použitím. Tento produkt je určen výhradně pro laboratorní výzkumné účely. Není určen pro humánní ani veterinární použití.

Specifikace produktu

Specifikace	Podrobnosti
Název produktu	LL-37
Množství	10 mg na lahvičku
Typ peptidu	Human Cathelicidin Antimicrobial Peptide
Sekvence aminokyselin	[LL-37, 37 aa]
Kategorie výzkumu	Immunology, Microbiology & Innate Immunity
Čistota	≥99,5% Testováno HPLC*
Formulář	Lyofilizovaný prášek
Dokumentace	Certifikát analýzy specifický pro danou šarži
Skladování	Skladujte při teplotě 2–8 °C, chraňte před světlem a vlhkostí

*Platí pro konkrétní šarži a platí certifikát pravosti.

Vědecký výzkum

Innate Immunity Research

LL-37 is widely investigated for its role within the innate immune system. Researchers study its interactions with microbial membranes, host defence mechanisms and peptide-mediated immune signalling pathways in controlled laboratory models.

Antimicrobial Peptide Research

As the only naturally occurring human cathelicidin peptide, LL-37 has been extensively investigated for its activity against Gram-positive bacteria, Gram-negative bacteria, fungi and certain enveloped viruses in experimental settings. These studies focus on understanding peptide–membrane interactions rather than clinical applications.

Wound Healing and Tissue Biology

Experimental research has explored the potential involvement of LL-37 in keratinocyte migration, angiogenesis and tissue repair processes. These findings remain part of ongoing preclinical research and continue to be investigated in laboratory models.

Immune Cell Signalling

LL-37 is also studied for its potential interactions with neutrophils, monocytes and T lymphocytes through immune signalling pathways, including receptors such as FPRL1/FPR2. These investigations contribute to a broader understanding of inflammatory regulation and innate immune responses.

Biofilm Research

Researchers continue to investigate LL-37 in experimental models involving bacterial biofilms and microbial persistence. This area of research is particularly relevant for understanding host–pathogen interactions and biofilm biology.

Inflammation Research

LL-37 has also been studied for its complex role in inflammatory signalling. Depending on the experimental model and biological environment, research suggests that the peptide may influence both pro-inflammatory and anti-inflammatory pathways, making it an important topic in immunological research.

Why Researchers Choose LL-37

• Kvalita výzkumné úrovně
• Vysoce čistý lyofilizovaný peptid
• Certifikát analýzy specifický pro danou šarži
• Spolehlivá konzistence dávek
• Bezpečné balení
• Rychlé dodání po celém světě
• Vyhrazená zákaznická podpora

Proč nakupovat od Peptides Divas?

Společnost Peptides Divas dodává prémiové výzkumné peptidy, které jsou podloženy transparentní kontrolou kvality a analytickou dokumentací specifickou pro jednotlivé šarže. Každá objednávka je pečlivě zabalena a rychle odeslána z našeho evropského skladu. Výzkumníci si vybírají Peptides Divas pro konzistentní kvalitu produktů, spolehlivé testování šarží a pohotovou zákaznickou podporu.

Pouze pro výzkumné účely

LL-37 10mg is supplied exclusively for scientific and laboratory research. This product is ne určené k lidské spotřebě, terapeutickému použití, diagnostickým postupům, kosmetickým aplikacím nebo veterinárnímu použití.